PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_021406-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 314aa    MW: 35356.1 Da    PI: 7.3681
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_021406-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.92e-072670345
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                     +W++ E +++ +a + + ++   +W ++a++++ g+t  +++  + 
  AHYPO_021406-RA 26 KWSQAENKIFENALAVYDKDtpdRWQKVAAMLP-GKTVGDVIKQYK 70
                     8********************************.****99988775 PP

2Myb_DNA-binding48.12.6e-15137181347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + k++G+g+W+ I+r +  +Rt+ q+ s+ qky
  AHYPO_021406-RA 137 PWTEEEHKLFLMGLKKYGKGDWRNISRNFVVTRTPTQVASHAQKY 181
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.9892275IPR017884SANT domain
Gene3DG3DSA:1.10.10.609.2E-42271IPR009057Homeodomain-like
SMARTSM007171.3E-82375IPR001005SANT/Myb domain
SuperFamilySSF466891.44E-112580IPR009057Homeodomain-like
CDDcd001677.63E-72672No hitNo description
PfamPF002495.9E-62670IPR001005SANT/Myb domain
PROSITE profilePS5129420.955130186IPR017930Myb domain
SuperFamilySSF466895.46E-17132185IPR009057Homeodomain-like
TIGRFAMsTIGR015579.1E-18133185IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.608.3E-13134181IPR009057Homeodomain-like
SMARTSM007172.7E-13134184IPR001005SANT/Myb domain
CDDcd001673.05E-11137182No hitNo description
PfamPF002495.6E-13137181IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MKWEMEVLSS YLSSASWLID ESRNTKWSQA ENKIFENALA VYDKDTPDRW QKVAAMLPGK  60
TVGDVIKQYK ELEDDVSNIE AGLVPIPGYD TTSAFTLEWI NNNGGYNDAY NHTYSPGGKR  120
GPPGVRPPDQ ERKKGVPWTE EEHKLFLMGL KKYGKGDWRN ISRNFVVTRT PTQVASHAQK  180
YFIRQLSGGK DKRRASIHDI TTVNLENESV SPDHNINNTN TNTNTKRSTS PDQYSTIHHP  240
NSTHFQWDQS SNGPAITFDS MQGNLLMPGY GSVGSYGFKV QGQNLQRNDF IENYVGPQNM  300
GFQIQATQNY PHG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A6e-1827921176RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00296DAPTransfer from AT2G38090Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010685614.11e-170PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H71e-125DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0K9RAW40.0A0A0K9RAW4_SPIOL; Uncharacterized protein
STRINGPOPTR_0009s04730.11e-140(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.18e-97MYB family protein